anti pdk1 rabbit polyclonal primary antibodies

PDK1 antibody LS-B689is an unconjugated rabbit polyclonal antibody to PDK1 (aa300-400) from human. It is reactive with human and mouse. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.IHC-plus™ PDK1 Polyclonal Antibody Rabbit anti-Human I…Was this helpful?People also askWhat is PDK1 antibody?What is P ...

How to make polyclonal rabbit antibodies?How to make polyclonal rabbit antibodies?For the production of polyclonal rabbit antibodies a wide range of antigens can be used (Table 1). When the purified (native) protein is available, it is usually the first choice for the antibody production. Purified proteins can be send at -20°C or -80°C to Davids wih cool packs or dry ice.Rabbit Antibodies - Davids Bio PDK1 Rabbit Polyclonal Antibody TA329402 OriGene

Polyclonal Immunogen The immunogen for anti-PDK1 antibody synthetic peptide directed towards the middle region of human PDK1. Synthetic peptide located within the following region ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

What is polyclonal antibody production?What is polyclonal antibody production?Polyclonal Antibody Production in Rabbits We use New Zealand white rabbits for the production of your polyclonal rabbit antibodies. It is the most used species to produce custom polyclonal antibodies and antisera. The advantages are a good amount of high-titer and high-affinity antibodies from the atisera at low costs.Rabbit Antibodies - Davids Bio What is polyclonal rabbit?What is polyclonal rabbit?Polyclonal Antibody Production in Rabbits. We use New Zealand white rabbits for the production of your polyclonal rabbit antibodies. It is the most used species to produce custom polyclonal antibodies and antisera. The advantages are a good amount of high-titer and high-affinity antibodies from the atisera at low costs.Rabbit Antibodies - Davids Bio100%(3)Anti-PDK1 (K235) Antibody (A25317) Antibodies

The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE). Product Form 1 mg/ml in Phosphate buffered saline (PBS) with 15 mM sodium azide, approx. pH 7.2.

100%(4)PDK1 Polyclonal antibody - Antibodies ELISA kits Proteins

PDK1 antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunoprecipitation (IP), Immunohistochemistry (IHC),Enzyme-linked Immunosorbent Assay (ELISA) applications. This antibody reacts with human, mouse samples.4.5/5(2)PDK1 antibody 7 products in Validated Antibody Database anti pdk1 rabbit polyclonal primary antibodiesIHC analysis of PDK1 using anti-PDK1 antibody (A01268-1). PDK1 was detected in paraffin-embedded section of rat testis tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins.4/5(1)Category Actin AssemblyPDK1 Rabbit Polyclonal Antibody AP22886PU-N OriGenePDK1 rabbit polyclonal antibody, Purified. Select your country/region. Select your country/region

4/5Phospho-PDK1 (Ser241) Antibody Cell Signaling Technology

Polyclonal Antibody for studying PDK1 (Ser241) phosphate in the PI3K / Akt Signaling research area. anti pdk1 rabbit polyclonal primary antibodies Secondary Antibody Conjugated to HRP Anti-rabbit IgG, HRP-linked Antibody . anti pdk1 rabbit polyclonal primary antibodies Use Normal Rabbit IgG #2729 for rabbit polyclonal primary antibodies, Rabbit anti pdk1 rabbit polyclonal primary antibodies4/5Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (NB100 Rabbit Polyclonal Anti-Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody. Validated WB, IB. Tested Reactivity Human, Mouse, Mouse, and more. 100% Guaranteed.5/5(1)Anti-PDK1 (Ab-241) Antibody IHC, IF Validated BosterbioThe membrane was incubated with rabbit anti-PDPK1 antigen affinity purified polyclonal antibody (Catalog # A01159) at 0.5 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-Rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT.

Anti PDK1 (pSer241) Antibody Bio-Rad

Rabbit anti PDK1 (pSer241) antibody recognizes PDK1, also known as 3-phosphoinositide-dependent protein kinase 1 or PDPK1, when phosphorylated at serine 241. PDK1 is a master kinase involved in numerous cell processes including proliferation, differentiation and cell survival.Anti-PDK1 (Phospho-Ser241) Antibody (A50184)Anti-PDK1 (Phospho-Ser241) Antibody (A50184) Rabbit polyclonal antibody to PDK1 (Phospho-Ser241) Validated Applications WB, IHC, IF. Tested Reactivity Human, Mouse, Rat.Anti-PDK1 Antibody (B8055) Rabbit Polyclonal anti pdk1 rabbit polyclonal primary antibodiesB8055 Anti-PDK1 Antibody detects endogenous levels of total PDK1 protein. Validated for WB and ELISA. Reactive for Human, Mouse, Rat. AssayBiotechnology an original antibody manufacturer.

Anti-PDK1 Antibody (SPC-1186) Rabbit Polyclonal anti pdk1 rabbit polyclonal primary antibodies

PDK1 Antibody - Rabbit polyclonal antibody to human 3-phosphoinositide-dependent protein kinase 1. Validated for use in WB, AM with human, mouse tissue.Anti-PDK1 Antibody, Rabbit Polyclonal, 12312-T16 Sino anti pdk1 rabbit polyclonal primary antibodiesAnti-PDK1 Rabbit Polyclonal Antibody (12312-T16), manufactured by Sino Biological is validated in ELISA. Custom antibody services and bulk production also available. To learn more comprehensive our antibody product information including immunogen, specificity, and more, you can read all details here.Anti-PDK1 Rabbit Polyclonal Antibody VWRIgGy Antibody Selector Quickly search hundreds of thousands of antibodies available for purchase from VWR by selecting common antibody features like antigen symbol and name, reactivity, clonality, conjugation, host, and other key factors. Antibodies used to identify and locate intracellular and extracellular proteins in common applications such as Western Blot, ELISA, ImmunoChemistry and anti pdk1 rabbit polyclonal primary antibodies

Anti-PDK1 antibody (STJ24945) St John's Labs

Polyclonal Antibodies Anti-PDK1 antibody (STJ24945) Western blot analysis of extracts of various cell lines, using PDK1 antibody (STJ24945) at 1:3000 dilution.Secondary antibody HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins 25ug per lane.Blocking buffer 3% nonfat dry milk in TBST.Detection ECL Basic Kit.Exposure time 10s.Anti-PDK1 antibody (ab90444) AbcamWestern blot - Anti-PDK1 antibody (ab90444) All lanes Anti-PDK1 antibody (ab90444) at 1/1000 dilution. Lane 1 HeLa cell lysate. Lane 2 Rat brain lysate. Lane Anti-PDK1 antibody produced in rabbit - Sigma-AldrichAnti-PDK1 antibody produced in rabbit Prestige Antibodies &Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution Synonym Anti-EC 2.7.11.2, Anti-Pyruvate dehydrogenase kinase isoform 1 MDL number MFCD01634055.

Anti-PDK1 polyclonal antibody (DPABH-19227) - Creative anti pdk1 rabbit polyclonal primary antibodies

Anti-PDK1 (aa 288-337) polyclonal antibody (DPABH-18807) Custom Antibody Labeling We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor&dyes, DyLight&Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 g up to 1 g of anti pdk1 rabbit polyclonal primary antibodiesAnti-PDK2 antibody - ERPAN TECHUnit. Availability. Price. Quantity. AB-06-3410. Anti-PDK2 antibody. Choose an option 50ug 100ug 250ug. In stock. Anti-PDK2 antibody quantity.Anti-PDPK1 / PDK1 antibody (GTX50366) GeneTexRabbit Polyclonal PDPK1 / PDK1 antibody. Validated in WB, ICC/IF, IHC-P. Tested in Human, Rat.

Anti-PDPK1 / PDK1 antibody (GTX59809) GeneTex

Rabbit Polyclonal PDPK1 / PDK1 antibody. Validated in WB, IP, IHC. Tested in Human, Mouse, Rat.Anti-PDPK1 antibody (ab186870) AbcamRabbit polyclonal PDPK1 antibody. Validated in WB, IHC, ICC/IF and tested in Mouse, Human. anti pdk1 rabbit polyclonal primary antibodies Anti-PDPK1 antibody PDPK1 primary antibodies. Description. Rabbit polyclonal to PDPK1. Host species. Rabbit. anti pdk1 rabbit polyclonal primary antibodies Anti-PDPK1 antibody (ab186870) at 1/500 dilution Lane 1 LOVO extractBrand Bioworld TechnologyCategory Primary Antibodiesanti-PDK1 antibody Product No. ABIN6034458Rabbit Polyclonal PDK1 antibody for IF/ICC, IHC, IP, WB. Order anti-PDK1 antibody ABIN6034458.

Brand Sigma-AldrichAnti-PDK1 Antibody A01268-2 - bosterbio

Boster Bio Anti-PDK1 Antibody catalog # A01268-2. Tested in Flow Cytometry, IP, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Supplied as 100ul in Liquid form antibody. Cite This Product Anti-PDK1 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01268-2) Antibodies Validation Antibodies Validation InformationBrand Sigma-AldrichPDK1 Rabbit anti-Human, HRP, Polyclonal Antibody, Abnova anti pdk1 rabbit polyclonal primary antibodiesShop a large selection of Western Blotting (WB) products and learn more about PDK1 Rabbit anti-Human, HRP, Polyclonal Antibody, Abnova 100µL; HRP:Life 100µL; HRP.Brand Signalway AntibodyCategory Primary AntibodiesIHC-plus PDK1 Polyclonal Antibody Rabbit anti-Human IHC anti pdk1 rabbit polyclonal primary antibodiesPDK1 antibody LS-B689 is an unconjugated rabbit polyclonal antibody to PDK1 (aa300-400) from human. It is reactive with human and mouse. Validated for

Category PDPK1 / PDK1Anti-Mitochondrial Pyruvate dehydrogenase kinase 1/PDK1 anti pdk1 rabbit polyclonal primary antibodies

Apr 15, 2019The membrane was incubated with rabbit anti-PDK1 antigen affinity purified polyclonal antibody (Catalog # A01268-1) at 0.5 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT.Category PDPK1 / PDK1Anti-PDK1 antibodyAvailability. Price. Quantity. AB-06-3409. Anti-PDK1 antibody. Choose an option 50ug 100ug 250ug. In stock. Anti-PDK1 antibody quantity. Add to cart.Category Polyclonal AntibodiesPrimary Antibody (Rabbit Anti-Chicken Polyclonal Antibody anti pdk1 rabbit polyclonal primary antibodiesPrimary Antibody (rabbit anti-chicken polyclonal antibody), 25µg, is for use with the ELISA Immuno Explorer Kit (#166-2400EDU). The product is lyophilized for shipping and long-term storage. Primary Antibody is included in the ELISA Kit Reagent Refill Package (#166-2401EDU).

Category Primary AntibodiesAnti-PDK1 Antibody Products Biocompare

Anti-PDK1 Antibody Products. Anti-PDK1 antibodies are offered by a number of suppliers. This target gene encodes the protein 'pyruvate dehydrogenase kinase 1' in humans and may also be known as pyruvate dehydrogenase kinase, isozyme 1, and [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial.Category Primary AntibodiesPDK1(Ser241) Polyclonal Antibody BiossPDK1(Ser241) Polyclonal Antibody Mouse bone lysates probed with Rabbit Anti-PDK1(ser241) Polyclonal Antibody, Unconjugated (bs-3327R) at 1:300 overnight at 4\u02daC. Followed by a conjugated secondary antibody (bs-0295G-HRP) at 1:5000 for 90 min at 37\u02daC.China Rabbit Anti-Collagen I Polyclonal Antibody - China anti pdk1 rabbit polyclonal primary antibodiesRabbit Polyclonal Antibody, Primary Antibodies, Polyclonal Antibody manufacturer / supplier in China, offering Rabbit Anti-Collagen I Polyclonal Antibody, Certificated Pipette Tips Non-Filter Dnase&Rnase Free Autoclaved Sterilized, Laboratory Supplies

IHC-plus PDK1 Polyclonal Antibody Rabbit anti-Human IHC anti pdk1 rabbit polyclonal primary antibodies

PDK1 antibody LS-B3690 is an unconjugated rabbit polyclonal antibody to PDK1 from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.Images of Anti Pdk1 Rabbit Polyclonal Primary Antibodies imagesPDK1 antibody Anti-PDK1|IHC IP WBRabbit polyclonal PDK1 antibody Home. Primary Antibodies . View All Primary Antibodies ; Monoclonal AntibodiesMonoclonal & Polyclonal Antibodies Bio-RadPrimary antibodies directly bind specific antigens with high specificity and affinity. They can be either monoclonal antibodies, which bind to a specific epitope, or polyclonal antibodies that bind to several epitopes of an antigen. Primary antibodies are predominantly used in immunoassays such as ELISA, western blot, immunohistochemistry, chromatin immunoprecipitation (ChIP), or flow cytometry.

PDK1 Antibody (PA1-16945)

The cells were labeled with PDK1 Polyclonal Antibody (Product # PA1-16945) at 5µg/ml in 0.1% BSA, incubated at 4 degree Celsius overnight and then labeled with Goat anti-Rabbit IgG (H+L) Superclonal Secondary Antibody, Alexa Fluor&488 conjugate (Product # A27034) at a dilution of 1:2000 for 45 minutes at room temperature (Panel a green).PDK1 Antibody (PA5-79797)The cells were labeled with PDK1 Polyclonal Antibody(Product # PA5-79797) at 1µg/mL in 0.1% BSA, incubated at 4 degree celsius overnight and then labeled with Goat anti-Rabbit IgG (H+L) Superclonal Recombinant Secondary Antibody, Alexa Fluor&488 conjugate (Product # A27034) at a dilution of 1:2000 for 45 minutes at room temperature (Panel a green).PDK1 Antibody 600-401-411 - Rocklandrabbit anti-PDK1 antibody, 3 Phosphoinositide Dependent Protein Kinase 1 antibody, hPDK 1 antibody, PDK 1 antibody, PDPK1 antibody, PDK-1 Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminal of human PDK-1 protein.

PDK1 Antibody Cell Signaling Technology

Polyclonal antibodies are produced by immunizing animals with a synthetic peptide corresponding to residues surrounding the carboxy terminus of human PDK1. Antibodies are purified by protein A and peptide affinity chromatography.PDK1 Polyclonal antibody - Antibodies ELISA kits ProteinsPDK1 antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF),Enzyme-linked Immunosorbent Assay (ELISA) applications. This antibody reacts with human, mouse, rat samples.PDK1 antibody (20R-1580) - fitzgerald-fiiRabbit polyclonal PDK1 antibody Home. Primary Antibodies . View All Primary Antibodies ; Monoclonal Antibodies

PDK1 antibody LS-B689is an unconjugated rabbit polyclonal antibody to PDK1 (aa300-400) from human. It is reactive with human and mouse. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.IHC-plus PDK1 Polyclonal Antibody Rabbit anti-Human I

Was this helpful?People also askWhat is PDK1 antibody?What is PDK1 antibody?PDK1 Antibody detects endogenous levels of total PDK1 protein. Polyclonal antibodies are produced by immunizing animals with a synthetic peptide corresponding to residues surrounding the carboxy terminus of human PDK1. Antibodies are purified by protein A and peptide affinity chromatography.PDK1 Antibody Cell Signaling TechnologyPDK1 antibody Western P3110 Sigma-AldrichThe 3-phosphoinositide-depend ent protein kinase-1 (PDK1, PKB kinase), is a master regulator of AGC kinases. It mediates cellular effects by activating major pathways involving PKB/Akt, S6K, RSK, SGK and the PKC isoforms. PDK1 is ubiquitously present in cells and is constitutively active.Product Overview anti-PDK1 Antibodiesanti-PDK1 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 1) (AA 172-399) Primary Antibody. PDK1 Reactivity Mouse ICC, IHC, WB Host Rabbit Polyclonal unconjugated. camera_alt 2.

Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (NB100

Rabbit Polyclonal Anti-Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody. Validated WB, ICC/IF. Tested Reactivity Human, Mouse, Rat, and more. 100% Guaranteed.Rabbit (polyclonal) Anti-Human 3--Phosphoinositide anti pdk1 rabbit polyclonal primary antibodiesWestern blot of HeLa cell lysate, using Invitrogens PDK1 antibody (cat. #AHZ0512). Proteins from HeLa cell lysates were resolved by SDS-PAGE and transferred to PVDF. Membranes were incubated with 0.25 µg/mL of this rabbit polyclonal anti-PDK-1 antibody. The signal was detected using a goat F(ab)2 anti-rabbit IgG alkaline phosphatase anti pdk1 rabbit polyclonal primary antibodiesRabbit Antibodies - Davids BioPolyclonal Antibody Production in Rabbits. We use New Zealand white rabbits for the production of your polyclonal rabbit antibodies. It is the most used species to produce custom polyclonal antibodies and antisera. The advantages are a good amount of high-titer and high-affinity antibodies from the atisera at low costs.

anti-Homo sapiens (Human) PDK1 Antibody raised in Rabbit anti pdk1 rabbit polyclonal primary antibodies

anti-PDK1 Antibody reacting with Rabbit and identified with ELISA, WB, IHC. Quality is guaranteed.

#

Contact With Us

Leave a Message

If you have any questions please fell free to contact with us.